SCOP 1.69: Domain d1rull2: 1rul L:108-214

Lineage for d1rull2 (1rul L:108-214)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)

8. Domain d1rull2: 1rul L:108-214 [97866]
   Other proteins in same PDB: d1rulh1, d1rulh2, d1rull1
   part of cationic cyclization catalytic Fab 4C6

Details for d1rull2

PDB Entry: 1rul, 1.88 Å

PDB Description: crystal structure (d) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 5.6 with a data set collected at ssrl beamline 11-1.

SCOP Domain Sequences for d1rull2:

Sequence; same for both SEQRES and ATOM records:

>d1rull2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1rull2:

• d1rull2 first appeared in SCOP 1.67
  
• d1rull2 appears in SCOP 1.71
  
• d1rull2 appears in the current release, SCOPe 2.08