SCOP 1.67: Domain d1rukh2: 1ruk H:114-231

Lineage for d1rukh2 (1ruk H:114-231)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1rukh2: 1ruk H:114-231 [97860]
   Other proteins in same PDB: d1rukh1, d1rukl1, d1rukl2
   part of cationic cyclization catalytic Fab 4C6
   complexed with act, bez, gol

Details for d1rukh2

PDB Entry: 1ruk, 1.4 Å

PDB Description: Crystal structure (C) of native cationic cyclization antibody 4C6 fab at pH 4.6 with a data set collected at SSRL beamline 9-1

SCOP Domain Sequences for d1rukh2:

Sequence; same for both SEQRES and ATOM records:

>d1rukh2 b.1.1.2 (H:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

Timeline for d1rukh2:

• d1rukh2 is new in SCOP 1.67
  
• d1rukh2 appears in SCOP 1.69
  
• d1rukh2 appears in the current release, SCOPe 2.08