SCOP 1.71: Domain d1rual1: 1rua L:1-107

Lineage for d1rual1 (1rua L:1-107)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)

8. Domain d1rual1: 1rua L:1-107 [97857]
   Other proteins in same PDB: d1ruah1, d1ruah2, d1rual2
   part of cationic cyclization catalytic Fab 4C6
   complexed with 4ht, act, bez, ghg, gol

Details for d1rual1

PDB Entry: 1rua, 1.75 Å

PDB Description: crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.

SCOP Domain Sequences for d1rual1:

Sequence; same for both SEQRES and ATOM records:

>d1rual1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

Timeline for d1rual1:

• d1rual1 first appeared in SCOP 1.67
  
• d1rual1 appears in SCOP 1.69
  
• d1rual1 appears in SCOP 1.73
  
• d1rual1 appears in the current release, SCOPe 2.08