Lineage for d1rual1 (1rua L:1-107)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 451612Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451743Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (126 PDB entries)
  8. 451758Domain d1rual1: 1rua L:1-107 [97857]
    Other proteins in same PDB: d1ruah1, d1ruah2, d1rual2
    part of cationic cyclization catalytic Fab 4C6

Details for d1rual1

PDB Entry: 1rua (more details), 1.75 Å

PDB Description: crystal structure (b) of u.v.-irradiated cationic cyclization antibody 4c6 fab at ph 4.6 with a data set collected at ssrl beamline 11-1.

SCOP Domain Sequences for d1rual1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rual1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

SCOP Domain Coordinates for d1rual1:

Click to download the PDB-style file with coordinates for d1rual1.
(The format of our PDB-style files is described here.)

Timeline for d1rual1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rual2