Lineage for d1ru9l1 (1ru9 L:1-107)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 363425Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363551Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)
  8. 363626Domain d1ru9l1: 1ru9 L:1-107 [97853]
    Other proteins in same PDB: d1ru9h1, d1ru9h2, d1ru9l2
    part of cationic cyclization catalytic Fab 4C6
    complexed with 4ht, act, bez, ghg, gol

Details for d1ru9l1

PDB Entry: 1ru9 (more details), 2.5 Å

PDB Description: Crystal Structure (A) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 4.6 with a data set collected in-house.

SCOP Domain Sequences for d1ru9l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ru9l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

SCOP Domain Coordinates for d1ru9l1:

Click to download the PDB-style file with coordinates for d1ru9l1.
(The format of our PDB-style files is described here.)

Timeline for d1ru9l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ru9l2