SCOP 1.73: Domain d1ru9h2: 1ru9 H:114-231

Lineage for d1ru9h2 (1ru9 H:114-231)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1ru9h2: 1ru9 H:114-231 [97852]
   Other proteins in same PDB: d1ru9h1, d1ru9l1, d1ru9l2
   part of cationic cyclization catalytic Fab 4C6
   complexed with 4ht, act, bez, ghg, gol

Details for d1ru9h2

PDB Entry: 1ru9, 2.5 Å

PDB Description: Crystal Structure (A) of u.v.-irradiated cationic cyclization antibody 4C6 Fab at pH 4.6 with a data set collected in-house.

PDB Compounds: (H:) immunoglobulin igg2a, heavy chain

SCOP Domain Sequences for d1ru9h2:

Sequence; same for both SEQRES and ATOM records:

>d1ru9h2 b.1.1.2 (H:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

Timeline for d1ru9h2:

• d1ru9h2 first appeared in SCOP 1.67
  
• d1ru9h2 appears in SCOP 1.71
  
• d1ru9h2 appears in SCOP 1.75
  
• d1ru9h2 appears in the current release, SCOPe 2.08