Lineage for d1ru8b_ (1ru8 B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 579981Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 580302Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 580303Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)
  6. 580393Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species)
  7. 580394Species Archaeon Pyrococcus furiosus [TaxId:2261] [102265] (1 PDB entry)
  8. 580396Domain d1ru8b_: 1ru8 B: [97850]
    structural genomics; NESG target PFR23
    complexed with trs

Details for d1ru8b_

PDB Entry: 1ru8 (more details), 2.7 Å

PDB Description: Crystal Structure of the putative n-type ATP pyrophosphatase from Pyrococcus furiosus, the Northeast Structural Genomics Target PfR23

SCOP Domain Sequences for d1ru8b_:

Sequence, based on SEQRES records: (download)

>d1ru8b_ c.26.2.1 (B:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral
giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp
awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag
eggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh

Sequence, based on observed residues (ATOM records): (download)

>d1ru8b_ c.26.2.1 (B:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh

SCOP Domain Coordinates for d1ru8b_:

Click to download the PDB-style file with coordinates for d1ru8b_.
(The format of our PDB-style files is described here.)

Timeline for d1ru8b_: