Lineage for d1ru8a_ (1ru8 A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families) 
share similar mode of ligand (Adenosine group) binding
can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other groupFamily c.26.2.1: N-type ATP pyrophosphatases [52403] (8 proteins) 
Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species) Species Archaeon Pyrococcus furiosus [TaxId:2261] [102265] (1 PDB entry) 
Domain d1ru8a_: 1ru8 A: [97849]
structural genomics; NESG target PFR23
Details for d1ru8a_
PDB Entry: 1ru8 (more details), 2.7 Å
PDB Description: Crystal Structure of the putative n-type ATP pyrophosphatase from Pyrococcus furiosus, the Northeast Structural Genomics Target PfR23
PDB Compounds: (A:) putative n-type ATP pyrophosphataseSCOP Domain Sequences for d1ru8a_:
Sequence, based on SEQRES records: (download)
>d1ru8a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral
giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp
awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag
eggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
Sequence, based on observed residues (ATOM records): (download)
>d1ru8a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
SCOP Domain Coordinates for d1ru8a_:
Click to download the PDB-style file with coordinates for d1ru8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ru8a_:
- d1ru8a_ first appeared in SCOP 1.67
- d1ru8a_ appears in SCOP 1.73
- d1ru8a_ does not appear in SCOPe 2.01
View in 3D
