SCOP 1.73: Domain d1ru8a_: 1ru8 A:

Lineage for d1ru8a_ (1ru8 A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (6 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.1: N-type ATP pyrophosphatases [52403] (7 proteins)

6. Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [102265] (1 PDB entry)

8. Domain d1ru8a_: 1ru8 A: [97849]

Details for d1ru8a_

PDB Entry: 1ru8, 2.7 Å

PDB Description: Crystal Structure of the putative n-type ATP pyrophosphatase from Pyrococcus furiosus, the Northeast Structural Genomics Target PfR23

PDB Compounds: (A:) putative n-type ATP pyrophosphatase

SCOP Domain Sequences for d1ru8a_:

Sequence, based on SEQRES records:

>d1ru8a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral
giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp
awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag
eggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh

Sequence, based on observed residues (ATOM records):

>d1ru8a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg
iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg
rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg
efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh

Timeline for d1ru8a_:

• d1ru8a_ first appeared in SCOP 1.67
  
• d1ru8a_ appears in SCOP 1.71
  
• d1ru8a_ last appears in SCOP 1.75