![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
![]() | Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins) |
![]() | Protein Putative N-type ATP pyrophosphatase PF0828 [102264] (1 species) |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [102265] (1 PDB entry) |
![]() | Domain d1ru8a_: 1ru8 A: [97849] |
PDB Entry: 1ru8 (more details), 2.7 Å
SCOP Domain Sequences for d1ru8a_:
Sequence, based on SEQRES records: (download)
>d1ru8a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus} gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymyhtinanltdlqaral giplvkgftqgekekevedlkrvlsglkiqgivagalaskyqrkriekvakelglevytp awgrdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvag eggefetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
>d1ru8a_ c.26.2.1 (A:) Putative N-type ATP pyrophosphatase PF0828 {Archaeon Pyrococcus furiosus} gladvavlysggkdsnyalywaiknrfsvkflvtmvseneesymytinanltdlqaralg iplvkgftqgekekevedlkrvlsglkiqgivagaskyqrkriekvakelglevytpawg rdakeymrellnlgfkimvvgvsaygldeswlgrildesaleelitlnekykvhvagegg efetfvldmplfkykivvdkakkvwepctssgkliieeahleskleh
Timeline for d1ru8a_: