Lineage for d1ru4a_ (1ru4 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470209Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 470210Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 470318Family b.80.1.9: Pectate transeliminase [101951] (1 protein)
    this is a repeat family; one repeat unit is 1ru4 A:216-242 found in domain
  6. 470319Protein Pectate transeliminase [101952] (1 species)
    type L pectate lyase, pel9a
  7. 470320Species Erwinia chrysanthemi [TaxId:556] [101953] (1 PDB entry)
  8. 470321Domain d1ru4a_: 1ru4 A: [97836]

Details for d1ru4a_

PDB Entry: 1ru4 (more details), 1.6 Å

PDB Description: Crystal structure of pectate lyase Pel9A

SCOP Domain Sequences for d1ru4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ru4a_ b.80.1.9 (A:) Pectate transeliminase {Erwinia chrysanthemi}
adcssdltsgistkriyyvapngnssnngssfnapmsfsaamaavnpgelillkpgtyti
pytqgkgntitfnksgkdgapiyvaaancgravfdfsfpdsqwvqasygfyvtgdywyfk
gvevtragyqgayvigshntfentafhhnrntgleinnggsyntvinsdayrnydpkkng
smadgfgpkqkqgpgnrfvgcrawensddgfdlfdspqkvvienswafrnginywndsaf
agngngfklggnqavgnhritrsvafgnvskgfdqnnnaggvtvinntsyknginygfgs
nvqsgqkhyfrnnvslsasvtvsnadaksnswdtgpaasasdfvsldtslatvsrdndgt
lpetslfrlsansklinagtkesnisysgsapdlgafern

SCOP Domain Coordinates for d1ru4a_:

Click to download the PDB-style file with coordinates for d1ru4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ru4a_: