Lineage for d1ru2a_ (1ru2 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 413110Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 413111Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 413112Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)
  7. 413113Species Escherichia coli [TaxId:562] [55086] (15 PDB entries)
  8. 413121Domain d1ru2a_: 1ru2 A: [97834]
    complexed with apc, cl, hhr, mg; mutant

Details for d1ru2a_

PDB Entry: 1ru2 (more details), 1.48 Å

PDB Description: crystal structure of a ternary complex of e.coli hppk(v83g/del84-89) with mgampcpp and 6-hydroxymethylpterin at 1.48 angstrom resolution (orthorhombic form)

SCOP Domain Sequences for d1ru2a_:

Sequence, based on SEQRES records: (download)

>d1ru2a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrggprtldldimlfgnevinterltvphydmknrgfmlw
plfeiapelvfpdgemlrqilhtrafdklnkw

Sequence, based on observed residues (ATOM records): (download)

>d1ru2a_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpppdylnaavaletslap
eellnhtqrielqqgrggprtldldimlfgnevinterltvphydmknrgfmlwplfeia
pelvfpdgemlrqilhtrafdklnkw

SCOP Domain Coordinates for d1ru2a_:

Click to download the PDB-style file with coordinates for d1ru2a_.
(The format of our PDB-style files is described here.)

Timeline for d1ru2a_: