Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) common fold is elaborated with additional secondary structures |
Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) |
Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species) |
Species Escherichia coli [TaxId:562] [55086] (15 PDB entries) |
Domain d1rtza_: 1rtz A: [97831] complexed with cl, gol, mg; mutant |
PDB Entry: 1rtz (more details), 1.33 Å
SCOP Domain Sequences for d1rtza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtza_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli} tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval etslapeellnhtqrielqqgrggprtldldimlfgnevinterltvphydmknrgfmlw plfeiapelvfpdgemlrqilhtrafdklnkw
Timeline for d1rtza_: