Lineage for d1rtza_ (1rtz A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 413110Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 413111Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 413112Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (2 species)
  7. 413113Species Escherichia coli [TaxId:562] [55086] (15 PDB entries)
  8. 413117Domain d1rtza_: 1rtz A: [97831]
    complexed with cl, gol, mg; mutant

Details for d1rtza_

PDB Entry: 1rtz (more details), 1.33 Å

PDB Description: crystal structure of e.coli apo-hppk(v83g/del84-89) at 1.33 angstrom resolution

SCOP Domain Sequences for d1rtza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtza_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli}
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrggprtldldimlfgnevinterltvphydmknrgfmlw
plfeiapelvfpdgemlrqilhtrafdklnkw

SCOP Domain Coordinates for d1rtza_:

Click to download the PDB-style file with coordinates for d1rtza_.
(The format of our PDB-style files is described here.)

Timeline for d1rtza_: