Lineage for d1rtyb_ (1rty B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441642Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (2 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 441647Family a.25.2.2: Cobalamin adenosyltransferase [89032] (2 proteins)
  6. 441651Protein Putative ATP-binding cobalamin adenosyltransferase YvqK [101138] (1 species)
  7. 441652Species Bacillus subtilis [TaxId:1423] [101139] (1 PDB entry)
  8. 441654Domain d1rtyb_: 1rty B: [97829]

Details for d1rtyb_

PDB Entry: 1rty (more details), 2.4 Å

PDB Description: Crystal Structure of Bacillus subtilis YvqK, a putative ATP-binding Cobalamin Adenosyltransferase, The North East Structural Genomics Target SR128

SCOP Domain Sequences for d1rtyb_:

Sequence, based on SEQRES records: (download)

>d1rtyb_ a.25.2.2 (B:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis}
mklytktgdkgqtglvggrtdkdslrvesygtidelnsfiglalaelsgqpgfedltael
ltiqhelfdcggdlaivterkdyklteesvsfletridaytaeapelkkfilpggskcas
llhiartitrraerrvvalmkseeihetvlrylnrlsdyffagarvvnarsgigdveyer

Sequence, based on observed residues (ATOM records): (download)

>d1rtyb_ a.25.2.2 (B:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis}
mklytdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaiv
terkdyklteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvv
almkseeihetvlrylnrlsdyffagarvvnarsgigdveyer

SCOP Domain Coordinates for d1rtyb_:

Click to download the PDB-style file with coordinates for d1rtyb_.
(The format of our PDB-style files is described here.)

Timeline for d1rtyb_: