SCOPe 2.08: Domain d1rtyb_: 1rty B:

Lineage for d1rtyb_ (1rty B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.2: Cobalamin adenosyltransferase [89032] (3 proteins)
   automatically mapped to Pfam PF01923

6. Protein Putative ATP-binding cobalamin adenosyltransferase YvqK [101138] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101139] (1 PDB entry)

8. Domain d1rtyb_: 1rty B: [97829]
   structural genomics; NESG target SR128
   complexed with po4

Details for d1rtyb_

PDB Entry: 1rty, 2.4 Å

PDB Description: Crystal Structure of Bacillus subtilis YvqK, a putative ATP-binding Cobalamin Adenosyltransferase, The North East Structural Genomics Target SR128

PDB Compounds: (B:) yvqk protein

SCOPe Domain Sequences for d1rtyb_:

Sequence, based on SEQRES records:

>d1rtyb_ a.25.2.2 (B:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]}
mklytktgdkgqtglvggrtdkdslrvesygtidelnsfiglalaelsgqpgfedltael
ltiqhelfdcggdlaivterkdyklteesvsfletridaytaeapelkkfilpggskcas
llhiartitrraerrvvalmkseeihetvlrylnrlsdyffagarvvnarsgigdveyer

Sequence, based on observed residues (ATOM records):

>d1rtyb_ a.25.2.2 (B:) Putative ATP-binding cobalamin adenosyltransferase YvqK {Bacillus subtilis [TaxId: 1423]}
mklytdslrvesygtidelnsfiglalaelsgqpgfedltaelltiqhelfdcggdlaiv
terkdyklteesvsfletridaytaeapelkkfilpggskcasllhiartitrraerrvv
almkseeihetvlrylnrlsdyffagarvvnarsgigdveyer

Timeline for d1rtyb_:

• d1rtyb_ first appeared in SCOP 1.67
  
• d1rtyb_ appears in SCOPe 2.07