Lineage for d1rtxa_ (1rtx A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349262Family a.1.1.1: Truncated hemoglobin [46459] (1 protein)
    lack the first helix (A)
  6. 349263Protein Protozoan/bacterial hemoglobin [46460] (5 species)
  7. 349267Species Cyanobacteria (Synechocystis sp.), pcc 6803 [TaxId:1148] [81667] (2 PDB entries)
  8. 349268Domain d1rtxa_: 1rtx A: [97827]
    complexed with cd, hem, k, so4

Details for d1rtxa_

PDB Entry: 1rtx (more details), 1.8 Å

PDB Description: Crystal Structure of Synechocystis Hemoglobin with a Covalent Heme Linkage

SCOP Domain Sequences for d1rtxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtxa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Cyanobacteria (Synechocystis sp.), pcc 6803}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapahkrdv
lnq

SCOP Domain Coordinates for d1rtxa_:

Click to download the PDB-style file with coordinates for d1rtxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rtxa_: