Lineage for d1rtwd_ (1rtw D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345656Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2345657Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2345817Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2345838Protein Putative transcriptional activator PF1337 [101459] (1 species)
  7. 2345839Species Pyrococcus furiosus [TaxId:2261] [101460] (1 PDB entry)
  8. 2345843Domain d1rtwd_: 1rtw D: [97826]
    structural genomics; NESG target PRF34
    complexed with mp5, po4

Details for d1rtwd_

PDB Entry: 1rtw (more details), 2.35 Å

PDB Description: X-ray Structure of PF1337, a TenA Homologue from Pyrococcus furiosus. Northeast Structural Genomics Research Consortium (Nesg) Target PFR34
PDB Compounds: (D:) transcriptional activator, putative

SCOPe Domain Sequences for d1rtwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtwd_ a.132.1.3 (D:) Putative transcriptional activator PF1337 {Pyrococcus furiosus [TaxId: 2261]}
mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak
apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle
gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg
efekerarevfkevskfelifwdiay

SCOPe Domain Coordinates for d1rtwd_:

Click to download the PDB-style file with coordinates for d1rtwd_.
(The format of our PDB-style files is described here.)

Timeline for d1rtwd_: