![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
![]() | Family a.132.1.3: TENA/THI-4 [101458] (9 proteins) Pfam PF03070; HO-related family lacking the heme-binding site |
![]() | Protein Putative transcriptional activator PF1337 [101459] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [101460] (1 PDB entry) |
![]() | Domain d1rtwc_: 1rtw C: [97825] structural genomics; NESG target PRF34 complexed with mp5, po4 |
PDB Entry: 1rtw (more details), 2.35 Å
SCOPe Domain Sequences for d1rtwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtwc_ a.132.1.3 (C:) Putative transcriptional activator PF1337 {Pyrococcus furiosus [TaxId: 2261]} mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmak apddllpffaesiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsfle gftalyceekayyeawkwvrenlkerspyqefinhwssqefgeyvkriekilnslaekhg efekerarevfkevskfelifwdiaygg
Timeline for d1rtwc_: