Lineage for d1rtrb_ (1rtr B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010549Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 protein domains)
  6. 2010550Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. 2010562Species Staphylococcus aureus [TaxId:1280] [101454] (1 PDB entry)
  8. 2010564Domain d1rtrb_: 1rtr B: [97821]

Details for d1rtrb_

PDB Entry: 1rtr (more details), 2.5 Å

PDB Description: Crystal Structure of S. Aureus Farnesyl Pyrophosphate Synthase
PDB Compounds: (B:) Geranyltranstransferase

SCOPe Domain Sequences for d1rtrb_:

Sequence, based on SEQRES records: (download)

>d1rtrb_ a.128.1.1 (B:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]}
tnlpmnklidevnnelsvainksvmdtqleesmlyslnaggkrirpvlllltldslntey
elgmksaialemihtyslihddlpamdnddyrrgkltnhkvygewtailagdalltkafe
lissddrltdevkikvlqrlsiasghvgmvggqmldmqsegqpidletlemihktktgal
ltfavmsaadianvddttkehlesysyhlgmmfqikddlldcygdeaklgkkvgsdlenn
kstyvsllgkdgaedkltyhrdaavdeltqideqfntkhlleivdlfysr

Sequence, based on observed residues (ATOM records): (download)

>d1rtrb_ a.128.1.1 (B:) Farnesyl diphosphate synthase (geranyltranstransferase) {Staphylococcus aureus [TaxId: 1280]}
tnlpmnklidevnnelsvainksvmdtqleesmlyslnaggkrirpvlllltldslntey
elgmksaialemihtyslihddlpamdnddyrrgkltnhkvygewtailagdalltkafe
lissddrltdevkikvlqrlsiasghvgmvggqmldmqsegqpidletlemihktktgal
ltfavmsaadianvddttkehlesysyhlgmmfqikddlldcstyvsllgkdgaedklty
hrdaavdeltqideqfntkhlleivdlfysr

SCOPe Domain Coordinates for d1rtrb_:

Click to download the PDB-style file with coordinates for d1rtrb_.
(The format of our PDB-style files is described here.)

Timeline for d1rtrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rtra_