Lineage for d1rsva_ (1rsv A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729327Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 1729361Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 1729398Domain d1rsva_: 1rsv A: [97817]
    complexed with azi, fe, hg; mutant

Details for d1rsva_

PDB Entry: 1rsv (more details), 2.2 Å

PDB Description: azide complex of the diferrous e238a mutant r2 subunit of ribonucleotide reductase
PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1rsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsva_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

SCOPe Domain Coordinates for d1rsva_:

Click to download the PDB-style file with coordinates for d1rsva_.
(The format of our PDB-style files is described here.)

Timeline for d1rsva_: