Lineage for d1rsrb_ (1rsr B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 911704Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 911853Protein Ribonucleotide reductase R2 [47257] (9 species)
  7. 911887Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)
  8. 911911Domain d1rsrb_: 1rsr B: [97816]
    complexed with azi, fe2, hg; mutant

Details for d1rsrb_

PDB Entry: 1rsr (more details), 2 Å

PDB Description: azide complex of the diferrous f208a mutant r2 subunit of ribonucleotide reductase
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1rsrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsrb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairayvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

SCOPe Domain Coordinates for d1rsrb_:

Click to download the PDB-style file with coordinates for d1rsrb_.
(The format of our PDB-style files is described here.)

Timeline for d1rsrb_: