![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.194: L27 domain [101287] (1 superfamily) 6 helices, heterodimer of 3-helical domains |
![]() | Superfamily a.194.1: L27 domain [101288] (1 family) ![]() |
![]() | Family a.194.1.1: L27 domain [101289] (4 proteins) |
![]() | Protein Peripheral plasma membrane protein cask [101296] (1 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [101297] (1 PDB entry) |
![]() | Domain d1rsod_: 1rso D: [97814] Other proteins in same PDB: d1rsoa_, d1rsoc_ mutant |
PDB Entry: 1rso (more details)
SCOP Domain Sequences for d1rsod_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rsod_ a.194.1.1 (D:) Peripheral plasma membrane protein cask {Rat (Rattus norvegicus)} gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks
Timeline for d1rsod_: