Lineage for d1rsoc_ (1rso C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. Family a.194.1.1: L27 domain [101289] (6 proteins)
  6. Protein Presynaptic protein sap97 [101294] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101295] (1 PDB entry)
  8. Domain d1rsoc_: 1rso C: [97813]
    Other proteins in same PDB: d1rsob_, d1rsod_

Details for d1rsoc_

PDB Entry: 1rso (more details)

PDB Description: Hetero-tetrameric L27 (Lin-2, Lin-7) domain complexes as organization platforms of supra-molecular assemblies
PDB Compounds: (C:) Presynaptic protein SAP97

SCOPe Domain Sequences for d1rsoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsoc_ a.194.1.1 (C:) Presynaptic protein sap97 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rkqdtqralhlleeyrsklsqtedrqlrssiervisifqsnlfqalidiqefyevtlldn

SCOPe Domain Coordinates for d1rsoc_ are not available.

Timeline for d1rsoc_:

Domains from other chains:
(mouse over for more information)
d1rsoa_, d1rsob_, d1rsod_