Lineage for d1rsob_ (1rso B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450415Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 450416Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 450417Family a.194.1.1: L27 domain [101289] (4 proteins)
  6. 450426Protein Peripheral plasma membrane protein cask [101296] (1 species)
  7. 450427Species Rat (Rattus norvegicus) [TaxId:10116] [101297] (1 PDB entry)
  8. 450428Domain d1rsob_: 1rso B: [97812]
    Other proteins in same PDB: d1rsoa_, d1rsoc_

Details for d1rsob_

PDB Entry: 1rso (more details)

PDB Description: hetero-tetrameric l27 (lin-2, lin-7) domain complexes as organization platforms of supra-molecular assemblies

SCOP Domain Sequences for d1rsob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsob_ a.194.1.1 (B:) Peripheral plasma membrane protein cask {Rat (Rattus norvegicus)}
gllaaeravsqvldsleeihaltdssekdldflhsvfqdqhlhtlldlydkintks

SCOP Domain Coordinates for d1rsob_:

Click to download the PDB-style file with coordinates for d1rsob_.
(The format of our PDB-style files is described here.)

Timeline for d1rsob_: