Lineage for d1rsfa1 (1rsf A:21-144)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021553Protein Coxsackie virus and adenovirus receptor (Car), domain 1 [48730] (1 species)
  7. 2021554Species Human (Homo sapiens) [TaxId:9606] [48731] (7 PDB entries)
  8. 2021574Domain d1rsfa1: 1rsf A:21-144 [97809]
    Other proteins in same PDB: d1rsfa2

Details for d1rsfa1

PDB Entry: 1rsf (more details)

PDB Description: nmr structure of monomeric car d1 domain
PDB Compounds: (A:) coxsackievirus and adenovirus receptor

SCOPe Domain Sequences for d1rsfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsfa1 b.1.1.1 (A:21-144) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]}
sittpeemiekakgetaylpckftlspedqgpldiewlispadnqkvdqviilysgdkiy
ddyypdlkgrvhftsndlksgdasinvtnlqlsdigtyqckvkkapgvankkihlvvlvk
psga

SCOPe Domain Coordinates for d1rsfa1:

Click to download the PDB-style file with coordinates for d1rsfa1.
(The format of our PDB-style files is described here.)

Timeline for d1rsfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rsfa2