![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (7 families) ![]() |
![]() | Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins) |
![]() | Protein Catalytic domain of MutY [48155] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [101348] (4 PDB entries) |
![]() | Domain d1rrsa1: 1rrs A:9-230 [97800] Other proteins in same PDB: d1rrsa2 protein/DNA complex; complexed with ca, sf4 |
PDB Entry: 1rrs (more details), 2.4 Å
SCOPe Domain Sequences for d1rrsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrsa1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk
Timeline for d1rrsa1: