SCOPe 2.01: Domain d1rrsa1: 1rrs A:9-230

Lineage for d1rrsa1 (1rrs A:9-230)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (4 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries)

8. Domain d1rrsa1: 1rrs A:9-230 [97800]
   Other proteins in same PDB: d1rrsa2
   protein/DNA complex; complexed with ca, sf4

Details for d1rrsa1

PDB Entry: 1rrs, 2.4 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an abasic site

PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrsa1:

Sequence; same for both SEQRES and ATOM records:

>d1rrsa1 a.96.1.2 (A:9-230) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakpstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkmk

Timeline for d1rrsa1:

• d1rrsa1 first appeared in SCOP 1.67
  
• d1rrsa1 appears in SCOP 1.75
  
• d1rrsa1 appears in SCOPe 2.02
  
• d1rrsa1 appears in the current release, SCOPe 2.08