SCOPe 2.07: Domain d1rrqa2: 1rrq A:234-360

Lineage for d1rrqa2 (1rrq A:234-360)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)

6. Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [103213] (5 PDB entries)

8. Domain d1rrqa2: 1rrq A:234-360 [97799]
   Other proteins in same PDB: d1rrqa1
   protein/DNA complex; complexed with ca, sf4

Details for d1rrqa2

PDB Entry: 1rrq, 2.22 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an A:oxoG pair

PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrqa2:

Sequence, based on SEQRES records:

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq
veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr
eykewas

Sequence, based on observed residues (ATOM records):

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvglqvelt
epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
was

Timeline for d1rrqa2:

• d1rrqa2 first appeared in SCOP 1.67
  
• d1rrqa2 appears in SCOPe 2.06
  
• d1rrqa2 appears in the current release, SCOPe 2.08