Lineage for d1rrqa2 (1rrq A:234-360)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 732099Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
  6. 732103Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)
  7. 732104Species Bacillus stearothermophilus [TaxId:1422] [103213] (3 PDB entries)
  8. 732105Domain d1rrqa2: 1rrq A:234-360 [97799]
    Other proteins in same PDB: d1rrqa1
    complexed with 8og, ca, fs4; mutant

Details for d1rrqa2

PDB Entry: 1rrq (more details), 2.22 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an A:oxoG pair
PDB Compounds: (A:) MutY

SCOP Domain Sequences for d1rrqa2:

Sequence, based on SEQRES records: (download)

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq
veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr
eykewas

Sequence, based on observed residues (ATOM records): (download)

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvglqvelt
epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
was

SCOP Domain Coordinates for d1rrqa2:

Click to download the PDB-style file with coordinates for d1rrqa2.
(The format of our PDB-style files is described here.)

Timeline for d1rrqa2: