SCOP 1.71: Domain d1rrqa1: 1rrq A:9-229

Lineage for d1rrqa1 (1rrq A:9-229)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (6 families)

5. Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins)

6. Protein Catalytic domain of MutY [48155] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries)

8. Domain d1rrqa1: 1rrq A:9-229 [97798]
   Other proteins in same PDB: d1rrqa2
   complexed with 8og, ca, fs4; mutant

Details for d1rrqa1

PDB Entry: 1rrq, 2.22 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an A:oxoG pair

SCOP Domain Sequences for d1rrqa1:

Sequence; same for both SEQRES and ATOM records:

>d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakcstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkm

Timeline for d1rrqa1:

• d1rrqa1 first appeared in SCOP 1.67
  
• d1rrqa1 appears in SCOP 1.69
  
• d1rrqa1 appears in SCOP 1.73
  
• d1rrqa1 appears in the current release, SCOPe 2.08