![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.96.1: DNA-glycosylase [48150] (6 families) ![]() |
![]() | Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins) |
![]() | Protein Catalytic domain of MutY [48155] (2 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries) |
![]() | Domain d1rrqa1: 1rrq A:9-229 [97798] Other proteins in same PDB: d1rrqa2 complexed with 8og, ca, fs4; mutant |
PDB Entry: 1rrq (more details), 2.22 Å
SCOP Domain Sequences for d1rrqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus} parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv gavlslaygvpepavngnvmrvlsrlflvtddiakcstrkrfeqivreimayenpgafne alielgalvctprrpscllcpvqaycqafaegvaeelpvkm
Timeline for d1rrqa1: