Lineage for d1rrqa1 (1rrq A:9-229)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358646Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358647Superfamily a.96.1: DNA-glycosylase [48150] (5 families) (S)
  5. 358655Family a.96.1.2: Mismatch glycosylase [48154] (3 proteins)
  6. 358656Protein Catalytic domain of MutY [48155] (2 species)
  7. 358657Species Bacillus stearothermophilus [TaxId:1422] [101348] (3 PDB entries)
  8. 358658Domain d1rrqa1: 1rrq A:9-229 [97798]
    Other proteins in same PDB: d1rrqa2
    complexed with 8og, ca, fs4; mutant

Details for d1rrqa1

PDB Entry: 1rrq (more details), 2.22 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an A:oxoG pair

SCOP Domain Sequences for d1rrqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus}
parefqrdlldwfarerrdlpwrkdrdpykvwvsevmlqqtrvetvipyfeqfidrfptl
ealadadedevlkaweglgyysrvrnlhaavkevktryggkvpddpdefsrlkgvgpytv
gavlslaygvpepavngnvmrvlsrlflvtddiakcstrkrfeqivreimayenpgafne
alielgalvctprrpscllcpvqaycqafaegvaeelpvkm

SCOP Domain Coordinates for d1rrqa1:

Click to download the PDB-style file with coordinates for d1rrqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rrqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rrqa2