![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.96: T-fold [55619] (1 superfamily) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
![]() | Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) ![]() bind purine or pterin in topologically similar sites between subunits |
![]() | Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins) beta-sheets of four subunits form a barrel, closed: n=16, S=16 |
![]() | Protein 7,8-dihydroneopterin aldolase [55629] (3 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [55630] (10 PDB entries) |
![]() | Domain d1rria_: 1rri A: [97797] complexed with a45 |
PDB Entry: 1rri (more details), 2 Å
SCOP Domain Sequences for d1rria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rria_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Staphylococcus aureus} mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren k
Timeline for d1rria_: