Lineage for d1rred_ (1rre D:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407595Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 407596Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 407815Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
    contains extra C-terminal alpha/beta subdomain
  6. 407816Protein ATP-dependent protease Lon (La), catalytic domain [102770] (1 species)
  7. 407817Species Escherichia coli [TaxId:562] [102771] (2 PDB entries)
  8. 407821Domain d1rred_: 1rre D: [97794]

Details for d1rred_

PDB Entry: 1rre (more details), 1.75 Å

PDB Description: crystal structure of e.coli lon proteolytic domain

SCOP Domain Sequences for d1rred_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rred_ d.14.1.10 (D:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli}
rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
ep

SCOP Domain Coordinates for d1rred_:

Click to download the PDB-style file with coordinates for d1rred_.
(The format of our PDB-style files is described here.)

Timeline for d1rred_: