SCOPe 2.05: Domain d1rreb_: 1rre B:

Lineage for d1rreb_ (1rre B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
   contains extra C-terminal alpha/beta subdomain
   automatically mapped to Pfam PF05362

6. Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)

7. Species Escherichia coli [TaxId:562] [102771] (6 PDB entries)

8. Domain d1rreb_: 1rre B: [97792]
   complexed with so4

Details for d1rreb_

PDB Entry: 1rre, 1.75 Å

PDB Description: crystal structure of e.coli lon proteolytic domain

PDB Compounds: (B:) ATP-dependent protease La

SCOPe Domain Sequences for d1rreb_:

Sequence; same for both SEQRES and ATOM records:

>d1rreb_ d.14.1.10 (B:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]}
rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
ep

Timeline for d1rreb_:

• d1rreb_ first appeared in SCOP 1.67
  
• d1rreb_ appears in SCOPe 2.04
  
• d1rreb_ appears in SCOPe 2.06
  
• d1rreb_ appears in the current release, SCOPe 2.08