Lineage for d1rreb_ (1rre B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2158021Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
    contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF05362
  6. 2158022Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)
  7. 2158023Species Escherichia coli [TaxId:562] [102771] (6 PDB entries)
  8. 2158031Domain d1rreb_: 1rre B: [97792]
    complexed with so4

Details for d1rreb_

PDB Entry: 1rre (more details), 1.75 Å

PDB Description: Crystal structure of E.coli Lon proteolytic domain
PDB Compounds: (B:) ATP-dependent protease La

SCOPe Domain Sequences for d1rreb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rreb_ d.14.1.10 (B:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]}
rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
ep

SCOPe Domain Coordinates for d1rreb_:

Click to download the PDB-style file with coordinates for d1rreb_.
(The format of our PDB-style files is described here.)

Timeline for d1rreb_: