SCOP 1.71: Domain d1rqwa_: 1rqw A:

Lineage for d1rqwa_ (1rqw A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
   sandwich; 11 strands in 2 sheets

4. Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family)
   has two smaller insertion domains

5. Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)

6. Protein Thaumatin [49876] (1 species)

7. Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (11 PDB entries)

8. Domain d1rqwa_: 1rqw A: [97781]
   complexed with tar

Details for d1rqwa_

PDB Entry: 1rqw, 1.05 Å

PDB Description: thaumatin structure at 1.05 a resolution

SCOP Domain Sequences for d1rqwa_:

Sequence; same for both SEQRES and ATOM records:

>d1rqwa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

Timeline for d1rqwa_:

• d1rqwa_ first appeared in SCOP 1.67
  
• d1rqwa_ appears in SCOP 1.69
  
• d1rqwa_ appears in SCOP 1.73
  
• d1rqwa_ appears in the current release, SCOPe 2.08