Lineage for d1rqwa_ (1rqw A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 370997Fold b.25: Osmotin, thaumatin-like protein [49869] (1 superfamily)
    sandwich; 11 strands in 2 sheets
  4. 370998Superfamily b.25.1: Osmotin, thaumatin-like protein [49870] (1 family) (S)
    has two smaller insertion domains
  5. 370999Family b.25.1.1: Osmotin, thaumatin-like protein [49871] (4 proteins)
  6. 371007Protein Thaumatin [49876] (1 species)
  7. 371008Species Ketemfe (Thaumatococcus daniellii) [TaxId:4621] [49877] (10 PDB entries)
  8. 371009Domain d1rqwa_: 1rqw A: [97781]
    complexed with tar

Details for d1rqwa_

PDB Entry: 1rqw (more details), 1.05 Å

PDB Description: thaumatin structure at 1.05 a resolution

SCOP Domain Sequences for d1rqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqwa_ b.25.1.1 (A:) Thaumatin {Ketemfe (Thaumatococcus daniellii)}
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtkggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta

SCOP Domain Coordinates for d1rqwa_:

Click to download the PDB-style file with coordinates for d1rqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1rqwa_: