Lineage for d1rqvb1 (1rqv B:1-51)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006038Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 2006039Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 2006040Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 2006041Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 2006042Species Escherichia coli [TaxId:562] [101379] (5 PDB entries)
  8. 2006046Domain d1rqvb1: 1rqv B:1-51 [97779]
    Other proteins in same PDB: d1rqva2, d1rqvb2
    includes hinge region 33-51 that adopts a helical conformation in chain A but is flexible in chain B

Details for d1rqvb1

PDB Entry: 1rqv (more details)

PDB Description: Spatial model of L7 dimer from E.coli with one hinge region in helical state
PDB Compounds: (B:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1rqvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqvb1 a.108.1.1 (B:1-51) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeek

SCOPe Domain Coordinates for d1rqvb1:

Click to download the PDB-style file with coordinates for d1rqvb1.
(The format of our PDB-style files is described here.)

Timeline for d1rqvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqvb2