Lineage for d1rqva1 (1rqv A:1-51)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775032Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 775033Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 775034Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 775035Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 775036Species Escherichia coli [TaxId:562] [101379] (5 PDB entries)
  8. 775045Domain d1rqva1: 1rqv A:1-51 [97777]
    Other proteins in same PDB: d1rqva2, d1rqvb2
    includes hinge region 33-51 that adopts a helical conformation in chain A but is flexible in chain B

Details for d1rqva1

PDB Entry: 1rqv (more details)

PDB Description: spatial model of l7 dimer from e.coli with one hinge region in helical state
PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOP Domain Sequences for d1rqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqva1 a.108.1.1 (A:1-51) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeek

SCOP Domain Coordinates for d1rqva1:

Click to download the PDB-style file with coordinates for d1rqva1.
(The format of our PDB-style files is described here.)

Timeline for d1rqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqva2