SCOPe 2.05: Domain d1rqta_: 1rqt A:

Lineage for d1rqta_ (1rqt A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
   multihelical; intertwined tetramer

4. Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family)

5. Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)

6. Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)

7. Species Escherichia coli [TaxId:562] [101379] (5 PDB entries)

8. Domain d1rqta_: 1rqt A: [97771]
   dimeric solution structure, similar to the SinR repressor dimerisation domain-like fold

Details for d1rqta_

PDB Entry: 1rqt

PDB Description: NMR structure of dimeric N-terminal domain of ribosomal protein L7 from E.coli

PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1rqta_:

Sequence; same for both SEQRES and ATOM records:

>d1rqta_ a.108.1.1 (A:) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
sitkdqiieavaamsvmdvvelisameekfgvsaaaa

Timeline for d1rqta_:

• d1rqta_ first appeared in SCOP 1.67
  
• d1rqta_ appears in SCOPe 2.04
  
• d1rqta_ appears in SCOPe 2.06
  
• d1rqta_ appears in the current release, SCOPe 2.07