Lineage for d1rqta_ (1rqt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006038Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 2006039Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 2006040Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 2006041Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 2006042Species Escherichia coli [TaxId:562] [101379] (5 PDB entries)
  8. 2006043Domain d1rqta_: 1rqt A: [97771]
    dimeric solution structure, similar to the SinR repressor dimerisation domain-like fold

Details for d1rqta_

PDB Entry: 1rqt (more details)

PDB Description: NMR structure of dimeric N-terminal domain of ribosomal protein L7 from E.coli
PDB Compounds: (A:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1rqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqta_ a.108.1.1 (A:) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
sitkdqiieavaamsvmdvvelisameekfgvsaaaa

SCOPe Domain Coordinates for d1rqta_:

Click to download the PDB-style file with coordinates for d1rqta_.
(The format of our PDB-style files is described here.)

Timeline for d1rqta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rqtb_