Lineage for d1rqrc2 (1rqr C:8-192)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 595566Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 595567Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) (S)
  5. 595568Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)
  6. 595569Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 595570Species Streptomyces cattleya [TaxId:29303] [102525] (2 PDB entries)
  8. 595576Domain d1rqrc2: 1rqr C:8-192 [97769]
    Other proteins in same PDB: d1rqra1, d1rqrb1, d1rqrc1
    complexed with 5fd, met

Details for d1rqrc2

PDB Entry: 1rqr (more details), 2.67 Å

PDB Description: crystal structure and mechanism of a bacterial fluorinating enzyme, product complex

SCOP Domain Sequences for d1rqrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqrc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOP Domain Coordinates for d1rqrc2:

Click to download the PDB-style file with coordinates for d1rqrc2.
(The format of our PDB-style files is described here.)

Timeline for d1rqrc2: