| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) ![]() |
| Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein) |
| Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
| Species Streptomyces cattleya [TaxId:29303] [102525] (2 PDB entries) |
| Domain d1rqrc2: 1rqr C:8-192 [97769] Other proteins in same PDB: d1rqra1, d1rqrb1, d1rqrc1 complexed with 5fd, met |
PDB Entry: 1rqr (more details), 2.67 Å
SCOP Domain Sequences for d1rqrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqrc2 c.132.1.1 (C:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr
Timeline for d1rqrc2:
View in 3DDomains from other chains: (mouse over for more information) d1rqra1, d1rqra2, d1rqrb1, d1rqrb2 |