Class b: All beta proteins [48724] (149 folds) |
Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (1 family) |
Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein) |
Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species) |
Species Streptomyces cattleya [TaxId:29303] [101855] (2 PDB entries) |
Domain d1rqrc1: 1rqr C:193-298 [97768] Other proteins in same PDB: d1rqra2, d1rqrb2, d1rqrc2 complexed with 5fd, met |
PDB Entry: 1rqr (more details), 2.67 Å
SCOP Domain Sequences for d1rqrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqrc1 b.141.1.1 (C:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya} paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea
Timeline for d1rqrc1:
View in 3D Domains from other chains: (mouse over for more information) d1rqra1, d1rqra2, d1rqrb1, d1rqrb2 |