Lineage for d1rqra1 (1rqr A:193-298)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 570087Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily)
    barrel, closed; n=7, S=10; greek-key topology; one overside connection
  4. 570088Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (1 family) (S)
  5. 570089Family b.141.1.1: Bacterial fluorinating enzyme, C-terminal domain [101853] (1 protein)
  6. 570090Protein 5'-fluoro-5'-deoxyadenosine synthase [101854] (1 species)
  7. 570091Species Streptomyces cattleya [TaxId:29303] [101855] (2 PDB entries)
  8. 570095Domain d1rqra1: 1rqr A:193-298 [97764]
    Other proteins in same PDB: d1rqra2, d1rqrb2, d1rqrc2

Details for d1rqra1

PDB Entry: 1rqr (more details), 2.67 Å

PDB Description: crystal structure and mechanism of a bacterial fluorinating enzyme, product complex

SCOP Domain Sequences for d1rqra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqra1 b.141.1.1 (A:193-298) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya}
paveqdgealvgvvsaidhpfgnvwtnihrtdlekagigygarlrltldgvlpfeapltp
tfadageigniaiylnsrgylsiarnaaslaypyhlkegmsarvea

SCOP Domain Coordinates for d1rqra1:

Click to download the PDB-style file with coordinates for d1rqra1.
(The format of our PDB-style files is described here.)

Timeline for d1rqra1: