Lineage for d1rqqd_ (1rqq D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918731Protein Adaptor protein Aps [103139] (1 species)
  7. 1918732Species Norway rat (Rattus norvegicus) [TaxId:10116] [103140] (2 PDB entries)
  8. 1918736Domain d1rqqd_: 1rqq D: [97763]
    Other proteins in same PDB: d1rqqa_, d1rqqb_
    complexed with insulin receptor kinase
    complexed with 112, mn

Details for d1rqqd_

PDB Entry: 1rqq (more details), 2.6 Å

PDB Description: Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS
PDB Compounds: (D:) adaptor protein APS

SCOPe Domain Sequences for d1rqqd_:

Sequence, based on SEQRES records: (download)

>d1rqqd_ d.93.1.1 (D:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
slnghgqchvqhlwfqsvfdmlrhf

Sequence, based on observed residues (ATOM records): (download)

>d1rqqd_ d.93.1.1 (D:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
slngqchvqhlwfqsvfdmlrhf

SCOPe Domain Coordinates for d1rqqd_:

Click to download the PDB-style file with coordinates for d1rqqd_.
(The format of our PDB-style files is described here.)

Timeline for d1rqqd_: