Lineage for d1rqqc_ (1rqq C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035347Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1035348Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1035349Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1035357Protein Adaptor protein Aps [103139] (1 species)
  7. 1035358Species Norway rat (Rattus norvegicus) [TaxId:10116] [103140] (2 PDB entries)
  8. 1035361Domain d1rqqc_: 1rqq C: [97762]
    Other proteins in same PDB: d1rqqa_, d1rqqb_
    complexed with insulin receptor kinase
    complexed with 112, mn

Details for d1rqqc_

PDB Entry: 1rqq (more details), 2.6 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps
PDB Compounds: (C:) adaptor protein APS

SCOPe Domain Sequences for d1rqqc_:

Sequence, based on SEQRES records: (download)

>d1rqqc_ d.93.1.1 (C:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
slnghgqchvqhlwfqsvfdmlrhf

Sequence, based on observed residues (ATOM records): (download)

>d1rqqc_ d.93.1.1 (C:) Adaptor protein Aps {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
slngqchvqhlwfqsvfdmlrhf

SCOPe Domain Coordinates for d1rqqc_:

Click to download the PDB-style file with coordinates for d1rqqc_.
(The format of our PDB-style files is described here.)

Timeline for d1rqqc_: