SCOP 1.71: Domain d1rqqc_: 1rqq C:

Lineage for d1rqqc_ (1rqq C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (31 proteins)
   Pfam 00017

6. Protein Adaptor protein Aps [103139] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [103140] (2 PDB entries)

8. Domain d1rqqc_: 1rqq C: [97762]
   Other proteins in same PDB: d1rqqa_, d1rqqb_

Details for d1rqqc_

PDB Entry: 1rqq, 2.6 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps

SCOP Domain Sequences for d1rqqc_:

Sequence, based on SEQRES records:

>d1rqqc_ d.93.1.1 (C:) Adaptor protein Aps {Rat (Rattus norvegicus)}
lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
slnghgqchvqhlwfqsvfdmlrhf

Sequence, based on observed residues (ATOM records):

>d1rqqc_ d.93.1.1 (C:) Adaptor protein Aps {Rat (Rattus norvegicus)}
lelsdypwfhgtlsrvkaaqlvlaggprshglfvirqsetrpgecvltfnfqgkakhlrl
slngqchvqhlwfqsvfdmlrhf

Timeline for d1rqqc_:

• d1rqqc_ first appeared in SCOP 1.67
  
• d1rqqc_ appears in SCOP 1.69
  
• d1rqqc_ appears in SCOP 1.73
  
• d1rqqc_ appears in the current release, SCOPe 2.08