SCOP 1.67: Domain d1rqqb_: 1rqq B:

Lineage for d1rqqb_ (1rqq B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Insulin receptor [56162] (1 species)
   PTK group; InsR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56163] (6 PDB entries)

8. Domain d1rqqb_: 1rqq B: [97761]
   Other proteins in same PDB: d1rqqc_, d1rqqd_
   complexed with adaptor protein Aps
   complexed with 112, mn; mutant

Details for d1rqqb_

PDB Entry: 1rqq, 2.6 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps

SCOP Domain Sequences for d1rqqb_:

Sequence; same for both SEQRES and ATOM records:

>d1rqqb_ d.144.1.7 (B:) Insulin receptor {Human (Homo sapiens)}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

Timeline for d1rqqb_:

• d1rqqb_ is new in SCOP 1.67
  
• d1rqqb_ appears in SCOP 1.69
  
• d1rqqb_ appears in the current release, SCOPe 2.08