SCOP 1.75: Domain d1rqqa_: 1rqq A:

Lineage for d1rqqa_ (1rqq A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Insulin receptor [56162] (1 species)
   PTK group; InsR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56163] (12 PDB entries)

8. Domain d1rqqa_: 1rqq A: [97760]
   Other proteins in same PDB: d1rqqc_, d1rqqd_
   complexed with adaptor protein Aps

Details for d1rqqa_

PDB Entry: 1rqq, 2.6 Å

PDB Description: crystal structure of the insulin receptor kinase in complex with the sh2 domain of aps

PDB Compounds: (A:) Insulin receptor

SCOP Domain Sequences for d1rqqa_:

Sequence; same for both SEQRES and ATOM records:

>d1rqqa_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

Timeline for d1rqqa_:

• d1rqqa_ first appeared in SCOP 1.67
  
• d1rqqa_ appears in SCOP 1.73
  
• d1rqqa_ appears in SCOPe 2.01
  
• d1rqqa_ appears in the current release, SCOPe 2.08