Lineage for d1rqqa_ (1rqq A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419524Protein Insulin receptor [56162] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 419525Species Human (Homo sapiens) [TaxId:9606] [56163] (6 PDB entries)
  8. 419531Domain d1rqqa_: 1rqq A: [97760]
    Other proteins in same PDB: d1rqqc_, d1rqqd_

Details for d1rqqa_

PDB Entry: 1rqq (more details), 2.6 Å

PDB Description: Crystal Structure of the Insulin Receptor Kinase in Complex with the SH2 Domain of APS

SCOP Domain Sequences for d1rqqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqqa_ d.144.1.7 (A:) Insulin receptor {Human (Homo sapiens)}
dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln
easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl
qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg
gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg
yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk

SCOP Domain Coordinates for d1rqqa_:

Click to download the PDB-style file with coordinates for d1rqqa_.
(The format of our PDB-style files is described here.)

Timeline for d1rqqa_: